PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011078663.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 302aa    MW: 31986 Da    PI: 6.6167
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011078663.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-393695362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  XP_011078663.1 36 HQALKCPRCDSVNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSK 95
                    6899****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-283693IPR003851Zinc finger, Dof-type
PfamPF027012.7E-333793IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6463993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MQDIHAIGGG GGGGGGGGRF FGGGDRRLRP HSHPSHQALK CPRCDSVNTK FCYYNNYNLS  60
QPRHFCKSCR RYWTKGGVLR NVPVGGGCRK TKRSKQKSSV APSGEAQRER SSNAQSSSSE  120
SSSLTAATTA ATPTSAMAEE GSAPSNTTSN SAVAYSFPDA RFFNASPNFD HQPIVNQPRD  180
GQIFTTEIGS FTTLMTSSSE MMGFGMGDIP TTSYSQAQEE NPKPVSENPG PGLLGTAAVE  240
ELKMQEMTGG LNNAAATLDW GSCGGGGGGE DEGLFDLTAA IDPAYWSQHQ WTDNDQSLNY  300
LP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11623GGRFFGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281321e-32AB028132.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-8.
GenBankAK0610001e-32AK061000.1 Oryza sativa Japonica Group cDNA clone:006-203-F09, full insert sequence.
GenBankAK1008921e-32AK100892.1 Oryza sativa Japonica Group cDNA clone:J023130J11, full insert sequence.
GenBankAK1013211e-32AK101321.1 Oryza sativa Japonica Group cDNA clone:J033034E07, full insert sequence.
GenBankAP0052841e-32AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAP0149581e-32AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-32CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankGQ1835321e-32GQ183532.1 Oryza sativa Japonica Group Dof-type zinc finger protein 05 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078663.10.0PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLA0A022Q6Q41e-96A0A022Q6Q4_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000103971e-64(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-49OBF binding protein 4